PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 292aa    MW: 33005.8 Da    PI: 6.8509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2333genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++v ++G g+W++++   g+ R +k+c++rw +yl
      Gh_A12G2333 17 KGLWSPEEDLKLRNYVLKHGHGCWSSVPINAGLLRNGKSCRLRWINYL 64
                     678*****************************99************97 PP

2Myb_DNA-binding55.11.8e-1770115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T++E+e ++ ++++lG++ W+ Ia+ ++ gRt++++k++w++yl
      Gh_A12G2333  70 RGTFTPQEEETILTLHHLLGNK-WSQIAQNLP-GRTDNEIKNYWHSYL 115
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-221167IPR009057Homeodomain-like
PROSITE profilePS5129416.751264IPR017930Myb domain
SuperFamilySSF466898.44E-2915111IPR009057Homeodomain-like
SMARTSM007173.4E-121666IPR001005SANT/Myb domain
PfamPF002492.2E-141764IPR001005SANT/Myb domain
CDDcd001672.20E-102064No hitNo description
PROSITE profilePS5129426.39665119IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2668119IPR009057Homeodomain-like
SMARTSM007171.9E-1669117IPR001005SANT/Myb domain
PfamPF002491.7E-1670115IPR001005SANT/Myb domain
CDDcd001674.85E-1272115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVSKPSENNK PKAKHKKGLW SPEEDLKLRN YVLKHGHGCW SSVPINAGLL RNGKSCRLRW  60
INYLRPGLKR GTFTPQEEET ILTLHHLLGN KWSQIAQNLP GRTDNEIKNY WHSYLKKRIA  120
KAEEMDSQAR SQCTTSSSEN KQSTPSPRIF SDQMPTYESF NHIDKLSVST DRAVPQHVID  180
FSKEPQRSPL PKVLFAEWLS LDQECGPAAT SYGFNHNSSS NFQDPFMDAF LLNEGTFGGS  240
DLHDGLSNGS ANEMFSSQFD FETQISGNEF VGSLSGDDIC SDFNMNNNVM YM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22171197108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440174.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K47e-57LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0B0PFQ30.0A0A0B0PFQ3_G
STRINGVIT_16s0050g00050.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.13e-54myb domain protein 19